PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010525035.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 447aa    MW: 48742.4 Da    PI: 8.7113
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010525035.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.54e-1562106147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r rW  eE++++v+a k++G   W++I +++g ++t+ q++s+ qk+
   XP_010525035.1  62 RERWADEEHKKFVEALKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 106
                      78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.08E-1556110IPR009057Homeodomain-like
PROSITE profilePS5129418.99257111IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.7E-859108IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-1560109IPR006447Myb domain, plants
SMARTSM007172.9E-1161109IPR001005SANT/Myb domain
PfamPF002494.9E-1262105IPR001005SANT/Myb domain
CDDcd001671.59E-864107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MVSSSSAMTV EGTCGGGRLT KAALRVGVSK SSDQQLQLNE QISGRKNFAP KVRKPYTITK  60
ERERWADEEH KKFVEALKLY GRAWRRIEEH VGTKTAVQIR SHAQKFFSKV ARDTTGSNGS  120
SVEPIVIPPP RPKRKPVHPY PRKLGNTSVK EISSTDQSRR SVSPNLSALE RDNQSPTSVL  180
SSVGSDAFGS ADSNSPNSSL SPVSYALQCE LMLSEPYGSA EASPSAALTT ATTAAEEPES  240
LKLELFPRQR LLSREESINQ PMKQSLKLFG KTVLLSDPNG SSALSTSCFC KSPQEANEGK  300
PIQPLPRKLT PAETSALNAE NILCWIQQNR QEATNACIEI SDLGGKEKGL QIEGSSTGSN  360
TCSDDDTGDA DKSSEVETPS SETNMEKKSE FKPSERSAFS QLKRTDSETR ARAFVPYRKR  420
KIVVETENKS SAMATETGED RNTSLCL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531092e-76AK353109.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-17-B24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010525035.10.0PREDICTED: protein REVEILLE 1
SwissprotF4KGY61e-138RVE1_ARATH; Protein REVEILLE 1
TrEMBLE4MX621e-136E4MX62_EUTHA; mRNA, clone: RTFL01-17-B24
TrEMBLV4N7S51e-136V4N7S5_EUTSA; Uncharacterized protein
STRINGAT5G17300.11e-136(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63562644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.11e-113MYB_related family protein